PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.2KG531900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MIKC_MADS
Protein Properties Length: 254aa    MW: 28733.5 Da    PI: 9.0431
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.2KG531900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF98.92e-311059251
                         ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
               SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                         rienk+nrqvtfskRrng+lKKA+E+SvLCdaeva+i+fs++g+lyeyss
  Pavir.2KG531900.1.p 10 RIENKINRQVTFSKRRNGLLKKAHEISVLCDAEVALIVFSTKGRLYEYSS 59
                         8***********************************************96 PP

2K-box94.22.2e-31881721498
                K-box  14 aeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                          ++++  e+  Lk +++ Lq++qR+llGe+L+sL++keLqqLeqqL++slk+iRs+Kn+l++++i+elqkkek+l ++n  L+k +
  Pavir.2KG531900.1.p  88 QANWGDEYGWLKTKLDALQKSQRQLLGEQLDSLTVKELQQLEQQLDSSLKHIRSRKNQLMFDSISELQKKEKSLTDQNGVLQKLM 172
                          67999*************************************************************************9998755 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006632.366161IPR002100Transcription factor, MADS-box
SMARTSM004323.0E-38160IPR002100Transcription factor, MADS-box
CDDcd002652.82E-42274No hitNo description
SuperFamilySSF554551.22E-32283IPR002100Transcription factor, MADS-box
PRINTSPR004047.6E-31323IPR002100Transcription factor, MADS-box
PfamPF003196.6E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004047.6E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004047.6E-313859IPR002100Transcription factor, MADS-box
PfamPF014861.2E-2987171IPR002487Transcription factor, K-box
PROSITE profilePS5129715.89188179IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 254 aa     Download sequence    Send to blast
MGRGPVQLRR IENKINRQVT FSKRRNGLLK KAHEISVLCD AEVALIVFST KGRLYEYSSN  60
DSMEGILERY QRYSFEERAV LDPNIGDQAN WGDEYGWLKT KLDALQKSQR QLLGEQLDSL  120
TVKELQQLEQ QLDSSLKHIR SRKNQLMFDS ISELQKKEKS LTDQNGVLQK LMEAEKEKNN  180
ALMNAHLREQ QNGASTSLPS PPPSTVPDSM PTLNIRPCQP REGTVGESEP ESSPAQVNSG  240
KLPPWMLRSV SNR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P2e-22174173Myocyte-specific enhancer factor 2B
1tqe_Q2e-22174173Myocyte-specific enhancer factor 2B
1tqe_R2e-22174173Myocyte-specific enhancer factor 2B
1tqe_S2e-22174173Myocyte-specific enhancer factor 2B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.177940.0leaf| root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4306950.0AJ430695.1 Zea mays mRNA for putative MADS-domain transcription factor (m28 gene).
GenBankBT0333970.0BT033397.1 Zea mays full-length cDNA clone ZM_BFb0049C14 mRNA, complete cds.
GenBankEU9629060.0EU962906.1 Zea mays clone 246416 MADS-box transcription factor 18 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004958248.11e-163PREDICTED: MADS-box transcription factor 18-like
SwissprotA2YNI21e-138MAD18_ORYSI; MADS-box transcription factor 18
SwissprotQ0D4T41e-138MAD18_ORYSJ; MADS-box transcription factor 18
TrEMBLK3ZWB41e-163K3ZWB4_SETIT; Uncharacterized protein
STRINGSi030896m1e-163(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP115137113
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69120.16e-69MIKC_MADS family protein